SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000968 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000968
Domain Number 1 Region: 67-200
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000017
Family Eukaryotic proteases 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000968   Gene: ENSPVAG00000001024   Transcript: ENSPVAT00000001024
Sequence length 201
Comment pep:novel genescaffold:pteVam1:GeneScaffold_4092:446:4155:-1 gene:ENSPVAG00000001024 transcript:ENSPVAT00000001024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWFLALSLGRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXFYQLWLGRQNLFDWEDTTQLFSDLTSFPHPKFSLSLLEDDFVSGEDRRDLTRLCR
ERPAEVAAAVKVLSQPTQEPQLGSTCCASGWSESHPVTSLLADLQWEDLEIPSSDGCAEA
YPQMVTDDCAGHVGDGTYTCV
Download sequence
Identical sequences ENSPVAP00000000968 ENSPVAP00000000968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]