SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001176 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001176
Domain Number 1 Region: 29-269
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.95e-85
Family Eukaryotic proteases 0.0000000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001176   Gene: ENSPVAG00000001252   Transcript: ENSPVAT00000001252
Sequence length 273
Comment pep:novel scaffold:pteVam1:scaffold_16115:4715:6025:1 gene:ENSPVAG00000001252 transcript:ENSPVAT00000001252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNLLVLALPLLLSPVHMVPAPRQALERVNIVGGKEAPGSKWPWQVSLRVKYQYWKHFCG
GSLIHPQWVLTAAHCVGPDFKNPTDLRVQLREQHLYYRDKLLPISRIIVHPEYYAIQAGF
DIALLELEDPVNISCQVQLVTLPPASETPPTPCWVTGWGDIDNGESLPPPFPLKQVKVPI
VENSICDSKYHTGLYTEDNVRIVRDDMMCAGNTKKDSCQGDSGGPLVCKVNGTWLQAGVV
SWGDGCAQPNRPGIYTRVTYYLDWIHRYVPEEP
Download sequence
Identical sequences ENSPVAP00000001176 ENSPVAP00000001176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]