SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001369 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001369
Domain Number 1 Region: 401-639
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.79e-52
Family Eukaryotic proteases 0.00019
Further Details:      
 
Domain Number 2 Region: 263-374
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-31
Family Kringle modules 0.00031
Further Details:      
 
Domain Number 3 Region: 99-147
Classification Level Classification E-value
Superfamily Kringle-like 1.83e-17
Family Fibronectin type II module 0.002
Further Details:      
 
Domain Number 4 Region: 160-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000212
Family EGF-type module 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000001369
Domain Number - Region: 197-237
Classification Level Classification E-value
Superfamily FnI-like domain 0.000335
Family Fibronectin type I module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001369   Gene: ENSPVAG00000001455   Transcript: ENSPVAT00000001455
Sequence length 649
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2489:69088:76434:1 gene:ENSPVAG00000001455 transcript:ENSPVAT00000001455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCRAWVPSPCALPRLSLFLLLLLLLAPLGAHPQAGRNHTDPAESNATVTPGTPTTTVAS
VARMTPAGSTPEAGRPQGRELTSLPGAAPSSPSLGSPVLTEDGQPCRFPFRYGGRMLHSC
TSAGSAHRKWCATTHNYDRDRAWGYCAQTPAPQEGPAASDPCASSPCLNGGSCTNTQAPE
SHHCTCPMAFTGKDCSVEKCFDETRYEHLEEGDRWARVHQGQAQRCECAGGRIHCEGTRH
TACLSSPCLNGGTCHLIVATGTTVCACPPGHAGRLCNIVPAQRCFTGSGTEYRGVASTAA
SGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDQDERPWCYVLKDQALSWEYC
PLEACESVPRTEHRLPNVLLTLPAPDARQTCGRRHKKRGSLRPRIVGGSSSLPGSHPWLA
AIYIGNSFCAGSLVHTCWVVSAAHCFSHSPPKDSISVVLGQHFFNRTTDVTQTFGIEKYI
PYPLYSVFNPSDHDLXXXXXXXXXXXXXXXXXXXXXXXXPEPSSPFPTGHKCQIAGWGHQ
DENASAYSGTLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLA
CEKNGVAYLYGTISWGDCGQLNKGVYTRANYVDWISDRIWPHKRLVNPS
Download sequence
Identical sequences ENSPVAP00000001369 ENSPVAP00000001369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]