SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001386 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001386
Domain Number 1 Region: 38-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.33e-37
Family SCAN domain 0.0000617
Further Details:      
 
Domain Number 2 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 392-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 310-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 196-237
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000144
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001386   Gene: ENSPVAG00000001471   Transcript: ENSPVAT00000001472
Sequence length 456
Comment pep:known_by_projection scaffold:pteVam1:scaffold_7284:16391:20084:-1 gene:ENSPVAG00000001471 transcript:ENSPVAT00000001472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPPEPQDQAPGEGEGLLIVKVEDSSWDQDSAQQEDSRDSEACRQRFRQFCYSDTGGPH
EAFSQLWELCCRWLRPELRTKEQILELLVLEQFLSVLPGGVRDWVREQCPRSGEEAVALV
EDLRKQPVRAWPKDVPSEVEPDATVQGSQAKRPPPIGARSRPPTWKHHSHGAQPRALLKE
GSTKQMTNTCFASGVHGPVTFGDIPFYFSQEEWGSLDLAQRDLFWDIKRENSRNVALGLG
LKSQSQRSQLEEAVTALPGQTGVDVTVAWNPEEAKAWESEARLGAPMGRAAGVRRGRPPT
RRRQFRDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCQECEKSFRSSSDLVRH
QGVHTGQKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHRRVH
TGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPMG
Download sequence
Identical sequences ENSPVAP00000001386 ENSPVAP00000001386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]