SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001389 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001389
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.8e-21
Family SCAN domain 0.00021
Further Details:      
 
Domain Number 2 Region: 491-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 452-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.86e-18
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 534-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.28e-17
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 313-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000054
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 6 Region: 374-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000835
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000001389
Domain Number - Region: 287-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000426
Family Classic zinc finger, C2H2 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001389   Gene: ENSPVAG00000001477   Transcript: ENSPVAT00000001475
Sequence length 594
Comment pep:known_by_projection scaffold:pteVam1:scaffold_7284:54151:57003:1 gene:ENSPVAG00000001477 transcript:ENSPVAT00000001475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRASLSRLRELCSYWLRPALHTKKQILELLVLEQFLSVLPPYLLARLQGQQLRDGEEV
VLLLEGVQRESIDVGPLDFSFNAGKNYPRADITLEEQGGPSQVSSHSPKKEVPPDGPPAL
EPSKELLPSQPEPSNPTEQGAWRCLPSSKQPLSPDPKRTFQALQESAPQGPKLWPEENSH
DQELAAVLESLTFEDGPAKKARPEHPLGFESRTPNEEGKEDPKGATCPATISAASQAGSP
RVVEDPQVQSLGQSSGVSSSLKKRSPTGKSEVLEVKVAEKPPTPEPEMKFICTECGVCFP
KLARLEGHQLRSHPGSRSFPCLSCGKIFGRNSILKLHMRTHTDERPHACHLCSHRFRQSS
HLNKHLQTHSEPAFLCAECGQGFQRRASLLQHLLAHARDQKAPCTQETKTKAQELAMVLC
SHCGQTFQRRSSLKRHLRIHAKDKGRQRSEHRPYVCSDCGKAFRRSEHLGAHLRVHTGER
PFSCQVCGRKFSQSSQLVCHQRVHTGEKPYSCPQCGKCFVRRAGLARHLLTHGGPRPHRC
AQCGKSFSQMQDLARHRHSHTGEKPCRCSECGEGFSQSKHLARHQRIHTGEKPH
Download sequence
Identical sequences ENSPVAP00000001389 ENSPVAP00000001389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]