SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001663 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001663
Domain Number 1 Region: 496-722
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.27e-55
Family Tandem AAA-ATPase domain 0.0000732
Further Details:      
 
Domain Number 2 Region: 621-675,841-998
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.63e-54
Family Tandem AAA-ATPase domain 0.0001
Further Details:      
 
Domain Number 3 Region: 248-296
Classification Level Classification E-value
Superfamily UBA-like 0.0000986
Family CUE domain 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000001663
Domain Number - Region: 395-431
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00311
Family Excinuclease UvrC C-terminal domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001663   Gene: ENSPVAG00000001760   Transcript: ENSPVAT00000001760
Sequence length 1022
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2605:38158:111996:1 gene:ENSPVAG00000001760 transcript:ENSPVAT00000001760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLFNLDRFRFEKRSKIEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSRAGTPDSDIT
EKTEDSSVPEAPVNERKASISYFKNEGGIQYIDLSSDSEDVVSPNCSNTVQETKFNKDTV
IIVSEPSEDEESEGLPAMAGRNNDDISELEDLSELEDLKDAKLQTLKELFPQRSDSDLLK
LIESTSTMDGAIAAALLMFGDAGGGPRKRKLSSSSEPYEEDEFNDDQSIKKKRLDHGEES
NESAESSNNWEKQESIVLKLQKEFPNFDKQELRDVLKEHEWMYSEALESLKVFAEDQDMQ
YASQSEFPNGKEVSSRSQNYPKSVTKTKLKQKCAMKPQNGFNKKRKKNVFNPKRVIEDSE
YDSGSDVGSSLDEDYSSGEEVMEDGYKGKILHFLQDASVAELTLIPQCSQKKAQKITELR
PFNSWEALFTKMFKTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNLTKQVTMLTGNG
GGWNIDQPSILNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLY
QESNKGPHLIVVPASTIDNWLREVNLWCPTLKVLCYYGSQEERKQIRYNIHSKYEEYNVI
VTTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINANNRLLLTGTPV
QNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKERIAHAKQIIKPFIL
RRVKDEVLKQLPPKDQIELCMSEQEQLYLGLREKSINNLVTEKNTEMCNVMMQLRKMANH
PLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYRHINNFQ
LDMDLILDSGKFRALGRILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKT
QISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCH
RVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQDMTTVDEGDEGSMPADIATLLKTSM
GL
Download sequence
Identical sequences ENSPVAP00000001663 ENSPVAP00000001663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]