SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000002509 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000002509
Domain Number 1 Region: 16-91
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000913
Family Snake venom toxins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000002509   Gene: ENSPVAG00000002656   Transcript: ENSPVAT00000002655
Sequence length 121
Comment pep:known_by_projection scaffold:pteVam1:scaffold_14955:15094:17542:1 gene:ENSPVAG00000002656 transcript:ENSPVAT00000002655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVFLLALLAALALQQGTALQCYFCVAQTSDKDCQHVQNCSDSETHCWTQRISVAGLIFLS
KGSSASCEDNSQNYYMVVSNTTCCSSDLCNASGARALRPALGPLLLLAAACSLMLWGPSQ
L
Download sequence
Identical sequences ENSPVAP00000002509 ENSPVAP00000002509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]