SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000002775 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000002775
Domain Number 1 Region: 153-241
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.28e-32
Family SCAN domain 0.0000479
Further Details:      
 
Domain Number 2 Region: 511-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 553-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 278-328
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-18
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 475-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-17
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000002775   Gene: ENSPVAG00000002938   Transcript: ENSPVAT00000002938
Sequence length 621
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3372:26859:47406:1 gene:ENSPVAG00000002938 transcript:ENSPVAT00000002938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGLPTAWFREPVTFEDVTLGFAPEEWGLLDLEHKSLYREVMLENYRNLVSVEHQLSKP
DVVSQLEEEEELWSVERGILQDTFSGCPEAQLDPELDTLPAGDPLTNITVVEVLTLNQEV
ARSRNAQIRALYAEDEGLSPEVLREPSQPLGRYPADPEAARQRFRGFRLEEAAGPRELAQ
LRELCRQWLRPEARSKEQVLEMLVLEQFLGALPGKLRVWVQSQHPEDCHEAVALVEDVNW
MSEEEASALATQEPTCSLEIPAQQKEKEEETSRPVKVLPEEPVTFLDVAVDFSTEEWGLL
DTTQRTEYHDVMLETFGHLVSVGWETTVESKPVTPPSAAPEGSTRNPKMEEPSGARARPS
TSGEGVPGAGPGVLGRALKSAGPAPELPGKQRREPPRADSGPPTSRVSQQKTRPRKRLRR
RGSGLRKGPRDARVQVPRQSRRGDQSAGGRGRERGPGRSSQQVTFTRIHKGSQVCRCSAC
GKTFRNPRYFSVHKKIHTGEKPYVCQDCGKAFIQSSSLTQHQRIHTGERPFQCRECGRTF
NDRSAISQHLRTHTGAKPYQCQVCRKAFRQSSHLVRHQRTHTGERPYACGKCGKAFTQSS
HLIGHQKTHSAAKRRKRPAAQ
Download sequence
Identical sequences ENSPVAP00000002775 ENSPVAP00000002775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]