SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000002911 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000002911
Domain Number 1 Region: 9-270
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.71e-61
Family Eukaryotic proteases 0.00039
Further Details:      
 
Domain Number 2 Region: 293-522
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.11e-49
Family Eukaryotic proteases 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000002911   Gene: ENSPVAG00000003086   Transcript: ENSPVAT00000003084
Sequence length 552
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2857:9079:13720:-1 gene:ENSPVAG00000003086 transcript:ENSPVAT00000003084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPSWGQGLLILGAVVLVEGLQGAQRACGQRGPGPPEPQEGKTELGEWPWQASVRRQGFH
ICSGSLVADTWVLTAAHCFEKATVTELNSWSVVLGSLQRKGLSPGAEEVGVTALQLPRAY
NHYSQGSDLALLQLAHPTAHMPLCLPQPGHRFPFGTSCWATGWDQDTNDAPRTLRNLRLR
LISRPTCNCLYNRLHQRLLASPARPGMLCGGAQPGVQGPCQGDSGGPVLCQEPDGHWVQT
GIISFTSSCAQEDTPVLLTDMAVYSSWLKARAQGAAFLAQNPETLEISDEDSCVACGSLR
REGPQAGAPSSWPWDARLKHQGKLACGGALVSEEVVLTAAHCFIGRQNPEEWSVGLGAGP
EEWGLKQLILHGAYTHPEGGYDVALLLLAEPVTLGPSLRPLCVPYADHHLPAGERGWVLG
LAQGAGTSFSQTVPVTILGLRACSRLHTTLGSDGIPLLPGMVCTSVVGELPCCEGLSGAP
LVHEVRGTWFLAGLHSFGDACQGPAQPAVFTALPTYENWVSSLDWQVYFTKEPEPEAETG
SCLANMSQPAGC
Download sequence
Identical sequences ENSPVAP00000002911 ENSPVAP00000002911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]