SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003128 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003128
Domain Number 1 Region: 7-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.57e-82
Family Eukaryotic proteases 0.00034
Further Details:      
 
Domain Number 2 Region: 416-528
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-28
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 3 Region: 317-405
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000301
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003128   Gene: ENSPVAG00000003312   Transcript: ENSPVAT00000003311
Sequence length 549
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3007:440100:454793:-1 gene:ENSPVAG00000003312 transcript:ENSPVAT00000003311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMSKNNLILLCGMICLEQGKSATLSLSKAPTCGQSLVKARPWNYFHIFSRIVGGSQVEK
GSYPWQVSLKRRQKHICGGTIISPQWVITAAHCVANRNIASTLNVTAGKHDLSRMEPGEQ
TLTIESIIIHPHFSRKKPMDYDIALLKMAGTFHFGQAVGPMCLPEPGERFKAGLICKTAG
WGRLTEDGILPQVLQEVNLPILTRKECVAALLTLKKPVSGQTFLCTGFPDGGRDACQGDS
GGSLMCQNKKGAWTLAGVTSWGLGCGRGWRNNVQKDDQGSPGIFTDLSKVLPWIHKHIQI
GKQRKSSRASCSEQDPVISEPEGELHFPESPYLYYDSKQLCVWTLLVSEEMHVLLIFSQL
DAESCHHNYLSIYSLEDRLIGKFCGERLASSVLVYATGFNLTYKALKPNYLPDSGCSSLT
VLFEEGRIQSLHYPEDYSDMADCNWVFQAPKHYLIKLSFQNMEIEESGDCTCDYVTVHRD
VERKKEIARLCGFVAPEPVLSFSGIMLISFQSDENVTFKGFQATVSFIPETGKKEAPTPW
VSIPILIMR
Download sequence
Identical sequences ENSPVAP00000003128 ENSPVAP00000003128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]