SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003304 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003304
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.6e-38
Family SCAN domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 566-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 403-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-17
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 231-291
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000017
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 
Domain Number 5 Region: 528-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000396
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003304   Gene: ENSPVAG00000003496   Transcript: ENSPVAT00000003494
Sequence length 640
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_106:196902:202025:-1 gene:ENSPVAG00000003496 transcript:ENSPVAT00000003494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALEPEDQDLWEEEGILMVKLEDDFTCRPESVLQKDDPVLETSHQNFRRFRYQEAASP
REALIRLRELCRQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVHGQEVLSEETLHPGAEPESPRELQDPAQTLTPEESHEETTQ
NPNLGAPEEQSLYHELEFQPLQESEVPVPQDPDIPEERNTGNPEMVALLTALSQGLVTFK
DVAVCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRLDEISQVREEPLVPDIL
ELQEPQEPEILSFTYTGDRSEDEEFLEQEDLNLEDLHRSVLGDLEIHQTPDWEIVFEDDP
GRPNERRFGTNISQVNSLTNLRETTPIHPLLGRHHDCPVCAKSFTCNSHLVRHLRTHTGE
KPYKCLECGKSYTRSSHLARHQKVHKMGTPYKCPLNRDLNETSPLVQLKSLEPYRCDDVK
HFRWTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLCGECGEDFSD
HRRYLAHRKTHAAEELYLCSECGRCFNHSAAFAKHLRGHASVRPCRCNECGKSFSRRDHL
VRHQRTHTGEKPFTCPTCGKSFSRGYHLIRHQRTHAEKTS
Download sequence
Identical sequences ENSPVAP00000003304 ENSPVAP00000003304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]