SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003509 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003509
Domain Number 1 Region: 102-174
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000162
Family Fibronectin type I module 0.048
Further Details:      
 
Domain Number 2 Region: 34-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000282
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 3 Region: 206-250
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000458
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003509   Gene: ENSPVAG00000003711   Transcript: ENSPVAT00000003710
Sequence length 358
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1690:1966:7833:1 gene:ENSPVAG00000003711 transcript:ENSPVAT00000003710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSVQGTSLCLPKRCLCLAVLLLRLLGQVSATEPCPTPCPAQCPETPPTCAPGVRAVLDD
RSRCLVCARQRGDSCSETEPCEEGRGLFCDRRADPSARSGICMAIEGDNCVFDGVIYQSG
ETFQPSCKYQCTCQDGQIGCVPRCDEDLLLPQPDCPAPRKVEVPGECCEKWICDSNETEA
LGDLHALPAYRTEATLGVSVSDSSSNCIEQTTEWSACSKSCGMGLSTRVTNRNPQCEMVK
QTRLCMVRPCEQEHKQPAEKKGKKCLRTTKSLKAIHLQFKNCTSLHAYKPRYCGVCSDGR
CCTPHNTKTIQVEFQCSPGQVIKKPVMVIGTCTCHNNCPHNNEAFLQELKPNTGRGNM
Download sequence
Identical sequences ENSPVAP00000003509 ENSPVAP00000003509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]