SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003742 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003742
Domain Number 1 Region: 15-185
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-49
Family Eukaryotic proteases 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003742   Gene: ENSPVAG00000003956   Transcript: ENSPVAT00000003956
Sequence length 185
Comment pep:known_by_projection scaffold:pteVam1:scaffold_25715:887:2928:-1 gene:ENSPVAG00000003956 transcript:ENSPVAT00000003956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSRTSPARGGGRLVLTSLLLLAITATINAAKTSVPPACGKPQQLNRIVGGEDSADAEW
PWVVSIQKNGTHHCAGSLLTNRWVVTAAHCFKDTLNKPTQFSVLLGAWQLGNPGLRSQEV
GIAWVQPHPVYSWKEGSRADIALVRLEHPIQFSERILPICLPDYSVHFPPNTDCWIAGWG
SISDG
Download sequence
Identical sequences ENSPVAP00000003742 ENSPVAP00000003742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]