SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003967 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003967
Domain Number 1 Region: 3-170
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.86e-47
Family Eukaryotic proteases 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003967   Gene: ENSPVAG00000004193   Transcript: ENSPVAT00000004189
Sequence length 170
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3270:667:4326:-1 gene:ENSPVAG00000004193 transcript:ENSPVAT00000004189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFHYSVKMGDRNIYKEVTSVVVPVQKIIIHPMFSSFGVTRHDLALLWLLYPVNFTVTIQP
ICIPEETFKVEAETRCWVTGWGRKEEFGELISYILQKVDQNIIFYEKCNEILQKTLLAKN
KVVLEGMICGYKGRGKDSCQGDSGGPMVCEFNDTWVQMGIVSWGVGCGHN
Download sequence
Identical sequences ENSPVAP00000003967 ENSPVAP00000003967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]