SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004100 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPVAP00000004100
Domain Number - Region: 86-133
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0906
Family Extracellular domain of cell surface receptors 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004100   Gene: ENSPVAG00000004331   Transcript: ENSPVAT00000004331
Sequence length 158
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3629:107315:114527:-1 gene:ENSPVAG00000004331 transcript:ENSPVAT00000004331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNHLLFWGVLVIFIKAILVTAQDEDERTLLVDNKCKCARITSRIIPSPEDPSQDIVERN
IRIKVPLNNRENISDPTSPRRTKFVYHLSDLCKNCDPAEVELDNQVVTVTQSNICDEDNE
TCYAYDRNKCYTNRVPLLYGGKTIMVETALTPDSCYPD
Download sequence
Identical sequences ENSPVAP00000004100 ENSPVAP00000004100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]