SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004244 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004244
Domain Number 1 Region: 316-395
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.01e-22
Family Eukaryotic proteases 0.0099
Further Details:      
 
Domain Number 2 Region: 474-527
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.5e-20
Family Eukaryotic proteases 0.0068
Further Details:      
 
Domain Number 3 Region: 181-229
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000419
Family Scavenger receptor cysteine-rich (SRCR) domain 0.052
Further Details:      
 
Domain Number 4 Region: 147-185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004244   Gene: ENSPVAG00000004476   Transcript: ENSPVAT00000004481
Sequence length 530
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2501:2337:23052:-1 gene:ENSPVAG00000004476 transcript:ENSPVAT00000004481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPASGPQPLLPGLCGVGVGYLRARTLSFLIRSRLGEPGKSCVYGKLQTLWASVPCLTFWG
RGPYEAEADLRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSL
LPLKFFPVIVIGVIALILALAIGLGVHFDCSGKYRCRSSFKCIDLTARCDGVFHCKDGED
EFRCVRVSGQGGVLQVFTDAAWRTVCTDDWKGHHASVACAQLGFPXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXEGCASGHVVTLKCTXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXHLCGGSVITPLWVVTAAHCVYDLYLPKSWTIQVGLVSLLDSPAP
SHLVEKILYHSKYKPKRLGNDIALMKLAGPLSFNXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDSGG
PLVCQERRVWKLVGATSFGIGCADVNKPGVYTRVTAFLDWIHEQMERDKT
Download sequence
Identical sequences ENSPVAP00000004244 ENSPVAP00000004244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]