SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004295 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004295
Domain Number 1 Region: 25-238
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-60
Family Eukaryotic proteases 0.0000000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004295   Gene: ENSPVAG00000004538   Transcript: ENSPVAT00000004537
Sequence length 416
Comment pep:known_by_projection scaffold:pteVam1:scaffold_3582:23667:28526:1 gene:ENSPVAG00000004538 transcript:ENSPVAT00000004537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVEMLPTAALLVLAASAAARDNSSCDAFCGRQFRQTAEGSSRIVGGQTATHRAWPWMVSL
QFFTYHDNRRYHACGGTLLNSQWLLTAAHCFREKKQVYEWRLIFGARDIEFGSNKPVKPP
LQERHVEKIIIHERYHPGLETNDIALLKITPPVLCGRFVGPGCLPQFSAGPPSIPQTCWV
IGWGFLRETDVQPTPVLQEARVNLLDLDLCNSSQWYNGRIFSTNLCAGYPEGKIDTCQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQS
TRPPAALPKPRRPCATVRPPWYFRPLPRPPPRTRLQAAPRPPALTPSPPSPPSPPSPFTP
SHPLAHAPGRPPFSGRPHALSFAKRLEQLMEILKGKTFINIRGNYESTDTPELTSS
Download sequence
Identical sequences ENSPVAP00000004295 ENSPVAP00000004295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]