SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004435 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004435
Domain Number 1 Region: 40-307
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.81e-81
Family Eukaryotic proteases 0.00000000983
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004435   Gene: ENSPVAG00000004684   Transcript: ENSPVAT00000004684
Sequence length 309
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3636:139619:145942:1 gene:ENSPVAG00000004684 transcript:ENSPVAT00000004684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRSGLPPSVPEMGPSQPTPPAFYPILESQALHFPNTPKLMMLRLLSSLLFVALALGCGRP
SYNPSTRVVNGEDAVPYSWPWQVSLQYEKNGNFHHTCGGSLIASSWVMTAGHCISSSVTY
QVVLGEYDRAENEGSEQVIPINAEDLFVHPLWNSSCVACGNDIALIKLSRHAQLGDTVQL
ACLPPAGDIVPNEAPCYISGWGRLYTGGPLPDKLQQALLPVVDYKHCSRWDWWGISLKKT
MVCAGGDTRSGCNGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTRKKPTVFTRVSAFND
WIEETIASH
Download sequence
Identical sequences ENSPVAP00000004435 ENSPVAP00000004435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]