SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004545 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004545
Domain Number 1 Region: 52-168,357-665
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.05e-70
Family Integrin alpha N-terminal domain 0.0000468
Further Details:      
 
Domain Number 2 Region: 188-381
Classification Level Classification E-value
Superfamily vWA-like 4.17e-47
Family Integrin A (or I) domain 0.00000116
Further Details:      
 
Domain Number 3 Region: 665-811
Classification Level Classification E-value
Superfamily Integrin domains 1.73e-31
Family Integrin domains 0.0038
Further Details:      
 
Domain Number 4 Region: 812-825,854-938
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000167
Family Integrin domains 0.0046
Further Details:      
 
Domain Number 5 Region: 994-1173
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000000994
Family Integrin domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004545   Gene: ENSPVAG00000004803   Transcript: ENSPVAT00000004803
Sequence length 1216
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1729:36857:148737:-1 gene:ENSPVAG00000004803 transcript:ENSPVAT00000004803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGAAPRRLPLWLAAPRRRSTPGPAAAPRAMELPRGLLVAWALSLWPGFTDTFNMDTRRPQ
IIPGSRESFFGYTVQQHDISGKKWLVVGAPLETNGHQKTGDVYKCPVIPGNCTKLNLGRV
TLSNVSERKDNMRLGLSLATNPKDNSFLACSPLWSHECGSSYYTTGMCSRVNSNFRFSKT
VAPALQRCQTYMDIVIVLDGSNSIYPWVEVQHFLINILKKFYIGPGQIQVGVVQYGEDVV
HEFHLNDYRSVTDVVEAASHIEQRGGTETRTAFGIEFARSEAFQKGGRKGAKKVMIVITD
GESHDSPDLEKVIQQSERDNVTRYAVAVLCYYNRRGINPEAFLNEIKYIASDPDDKHFFN
VTDAALKDIVDALGDRIFSLEGTNKNETSFGLEMSQTGFSSHVVEDGILLGAVGAYDWNG
AVLKETTGGKVIPLRESYLKEFPEELKNHGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTG
KAILFTMHNNRSLTIHQSLRGEHIGSYYGSEITSVDIDGDGVTDVLLVGAPMYFSEGRER
GRVYVYNLRQNRFVYNGTLKDSHSYQNARFGSSIAAVQDLNQDSYNDVVVGAPLEDNHGG
AIYVFHGFRGSLLKTPKQRIAASELAPGLQYFGCSIHGELDLNEDGLVDLAVGGLGNAVI
LWSRPVVQVNASLHFEPPKINIFHRDCKRSGRDATCLAAFLCFTPIFLAPHFESATVGIR
YNATMDEKRYTPRAHLDDSGDRYTNRAVLLSSGQEHCERINFHVLDTADYVKPVTFSVEY
SLEDPNYGPMLDDGWPTTLRVSVPFWNGCNEDEHCVPDLLLDARSDLPTAMEYCQRVLRK
PAQDCSAYTLSFDTTVFIIESTRRRVAVEAMLENRGENAYSTVLNISQSANLQFASLIQK
DDSDGSIECVNEEKRLHKKVCNVSYPFFRAKAKVAIRLDSXXXXXXXXXXXXXXXXXXXD
SDEEESTKEDNTVLLRFHLKYEADILFTRSSSLSHYEIKPNSSLERYDGIGPPFNCIFKI
QNLGLFPVHGVMMKITVPIATRGGNRLLMLRDFLTDQVNTSCNVWGNSTEYRHAPMEEDL
SRAPQLNHSNSDVVSINCNVRLAPNQEINFHLLGNLWLRSLKALKYKLMKITVNAALQRQ
FHSPFIFREEDPSRQITFEISKQEDWQIPIWIIVGSTLGGLLLLALLVLALWKLGFFRSA
KRRREPGLDPTPKTLE
Download sequence
Identical sequences ENSPVAP00000004545 ENSPVAP00000004545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]