SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004710 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004710
Domain Number 1 Region: 166-415
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.36e-84
Family Eukaryotic proteases 0.00028
Further Details:      
 
Domain Number 2 Region: 41-104
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000392
Family SEA domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004710   Gene: ENSPVAG00000004981   Transcript: ENSPVAT00000004981
Sequence length 416
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3556:34779:47353:-1 gene:ENSPVAG00000004981 transcript:ENSPVAT00000004981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRFGTFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIYHYQGDFLISGVIYND
SCENAASQASTDLNKDIETKMLDAFQNSSIYKEYVNSQVIKLLXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLMEISKANAEMLTNNCCGRQVANSMI
AGNRIVNGENTLAGAWPWQASMQWKGQHHCGASLISSRWLLSAAHCFNKKNNSEDWTVNF
GTVINKPYRTGKVQNVISHENYNRAGVHDDIALVQLAEEVSFTKYVRRICLPEAKMKLSE
NDSVVVTGWGTLYMNGPTPKILQQAFVKIIDNKVCNAPHALSGFVTDKMLCAGFMSGEAD
ACQNDSGGPLAYPDSRNIWHLVGIVSWGEGCAKKNKPGVYTRVTAYRDWITSKTGL
Download sequence
Identical sequences ENSPVAP00000004710 ENSPVAP00000004710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]