SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004757 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004757
Domain Number 1 Region: 3-234
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.88e-66
Family Eukaryotic proteases 0.000000787
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004757   Gene: ENSPVAG00000005029   Transcript: ENSPVAT00000005029
Sequence length 242
Comment pep:known_by_projection scaffold:pteVam1:scaffold_16382:5746:8276:-1 gene:ENSPVAG00000005029 transcript:ENSPVAT00000005029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLLLLLVAFLLPPRAGAGEIIGGQEARPHSHPYMAFLQIQSPGTTCGGFLVREDFVMTA
ARCNGSRIRVILGAHNIRREERTQQRLSVLRAIRHPQYDPQNNLNDIMLLQLKNRARRNR
FVRPVALPQTQARLNPGTSCTVAGWGLVSLKGRTDTLRDVRLRVQRDQECSRRFRAYTGQ
TEICVGDRRERGDTGGPLVCNNVAQGVVSYGKGTPPAVFTRVARFLPWINNTMARFKQQQ
TE
Download sequence
Identical sequences ENSPVAP00000004757 ENSPVAP00000004757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]