SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004802 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004802
Domain Number 1 Region: 2-34,71-257
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-67
Family Eukaryotic proteases 0.0000000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004802   Gene: ENSPVAG00000005074   Transcript: ENSPVAT00000005076
Sequence length 257
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1915:1091:9694:1 gene:ENSPVAG00000005074 transcript:ENSPVAT00000005076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISLQYYSSGQWRHTCGGSLVAKDWVLTAAHCISETSLIDQSAHRVLRHCSPVLPSQRDLC
LSQLALPGVSSRTYRVLLGRQSLSTDEDGSLAVQVSKLVVNENWNPNKLTQGNDIALLKL
ANPVSLSDKIQLGCLPPAGSILPNNYVCYVTGWGRLQTNGALPDILQQGQLLVVDYATCS
SRGWWGSSVKTNMICAGGDGVISSCNGDSGGPLNCQGANGQWEVHGVVSFGSSLGCNYYH
KPSVFTRVSNYIDWINS
Download sequence
Identical sequences ENSPVAP00000004802 ENSPVAP00000004802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]