SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004857 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004857
Domain Number 1 Region: 454-744
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.91e-53
Family Eukaryotic proteases 0.0000127
Further Details:      
 
Domain Number 2 Region: 187-454
Classification Level Classification E-value
Superfamily vWA-like 7.09e-50
Family Integrin A (or I) domain 0.0000176
Further Details:      
 
Domain Number 3 Region: 82-143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.00033
Further Details:      
 
Domain Number 4 Region: 149-205
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000403
Family Complement control module/SCR domain 0.00033
Further Details:      
 
Domain Number 5 Region: 24-91
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000278
Family Complement control module/SCR domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004857   Gene: ENSPVAG00000005131   Transcript: ENSPVAT00000005131
Sequence length 751
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3914:67154:77454:1 gene:ENSPVAG00000005131 transcript:ENSPVAT00000005131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLMALLCLLSLYPGLAAAAPSCPQNVKISGGNFTLSHGWAPGSVLIYSCPPGHYPSPV
SRLCLSNGQWQTLRSTRLTKAVCKPVRCPAPVSFENGMYTPRLGSHPVGGNLSFECDDGF
TLRGSSVRRCRPNGMWDGETAVCDNGASHCSNPGISVGSVRTGSRFGLGDKVSYRCSSNL
VLTGSAERECQSNGVWSGTEPICRQPYSYDFPEDVAPALGTSLSHLLGATNPTQKKNENV
GRKIQIQRSGHLNLYLLLDASQSVAEDDFRVFKESAILMVDRIFSFEINVSVAIITFASK
PKIIMSVLYDSSRDVTEVIDRLDNINYKDHENGTGTNTYEALNSVYIMMNNQMQRLGMKT
AAWLEIRHAIILLTDGKSNMGGSPKPAIDSIKEILNINQKRNDYLDIYAIGVGKLEVDWR
ELNELGSKKDGERHAFILQDTKALYEVFEHMLDVSQLIDTICGVGNMSANASAQERTPWH
VTIKPKSHETCRGALISDQWVLTAAHCFRHADEDRSLWRVNVGDPNSQWGKDFQIEKAVI
SSGFNVFAKKQQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTVGANLALRRPPGSTC
REHENELLDKLSVPAHFVALNGDKLNINLKTGTEWTSCIKVVSQDKKTFPNLTDVKEVVT
DQFLCSGTKEDDNPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCGSSDKNSRKRAPRGK
VPEPRDFHINLFRLQPWLRQHLEGVLNFLPL
Download sequence
Identical sequences ENSPVAP00000004857 ENSPVAP00000004857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]