SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004860 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004860
Domain Number 1 Region: 474-762
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.51e-59
Family Eukaryotic proteases 0.00000000058
Further Details:      
 
Domain Number 2 Region: 202-471
Classification Level Classification E-value
Superfamily vWA-like 2.08e-57
Family Integrin A (or I) domain 0.0000000123
Further Details:      
 
Domain Number 3 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000361
Family Complement control module/SCR domain 0.0000299
Further Details:      
 
Domain Number 4 Region: 98-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000101
Family Complement control module/SCR domain 0.0000275
Further Details:      
 
Domain Number 5 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000216
Family Complement control module/SCR domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004860   Gene: ENSPVAG00000005133   Transcript: ENSPVAT00000005134
Sequence length 768
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3914:78234:84198:1 gene:ENSPVAG00000005133 transcript:ENSPVAT00000005134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRNLSLRLCLVPLVLGLLSRGGSTTPLPEARPQGFCSLEGVEIKGGSFRLLKEGQALEY
VCPSGFYPYPVQARICRSTGSWSTLQTKDQKIVKKAECRAIHCPRPQDFENGEYWPRAPY
YNLSDEISFHCYDGYTLRGSVNRTCQVTGRWDGQTAICDNGAGYCPNPGIPIGTRKVGNQ
YRLEDSVTYYCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPEEVAEAFLSSLTE
TIEGVDAEDGHSPGEQQKRKIVLDPSGSMNIYLVLDGSDSVGAHNFTGAKNCLRDFIEKV
ASYGVKPKYGLVTYATDTNILIRVSDAESSNADWVTEKLNKISYEDHKLKTGTNTKKALQ
AVYSMMGWEGNTRPEGWNHTRHVIILMTDGLHNMGGDPVPVIHDIRALLDIGRDRKNPRE
DYLDVYVFGVGPLVNQENINALASKKDQENHVFKVKDMENLENVFFQMLDETRTLGLCGM
VWEHRDGSDYHKQPWQVKISVTRPSKGHENCMGAVVSEYFVLTAAHCFTVDDQKHSIKVS
MGGMKQELEIEEVLFHPKYNINGKKEKGIPEFYDYDVALIKLKKKLTYSETVRPICLPCT
EGTNQALRLPRSTTCQRQMEELLPAKDIKALFVSELTKDRKKMLARKEVYIKNGDKKAGC
ERDAQKAPGYEQVKDISEVVTPRFLCTGGVTPYADPNTCRGDSGGPLIIHKRSRFIQVGV
ISWGVVDVCKDHGRRQQVPAHARDFHINLFQVLPWLKEKLQDENLDFL
Download sequence
Identical sequences ENSPVAP00000004860 ENSPVAP00000004860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]