SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004902 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004902
Domain Number 1 Region: 35-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.07e-39
Family SCAN domain 0.000049
Further Details:      
 
Domain Number 2 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 272-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 411-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.85e-19
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 310-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004902   Gene: ENSPVAG00000005181   Transcript: ENSPVAT00000005178
Sequence length 470
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2077:141187:144561:1 gene:ENSPVAG00000005181 transcript:ENSPVAT00000005178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTKVLGMATGLGPRPPQEQVGLKIGEEKEKCFPSLEMFRQRFRQFGYHDTPGPREALSQ
LRVLCCEWLRPEIHTKEQILELLVLEQFLTILPRELQAWVQEHCPESAEEAVTLLEDLEQ
ELDEPGQQVSPPPNKHKQVWAMSSSGTAKESLSSTQPQSVETSPKYESWGPLYIQETGEE
QDFTPELRQIQDCKSNTQNEESTDMQKSSEESHAEEFKKDIIPMIITNKCEARLEKQWEN
LEEERGIKTPVVDKGSKKGRELMPIKPAPGERRYICAECGKAFSNSSNLTKHRRTHTGEK
PYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCK
DCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKECGK
AFNHSSNFNKHHRIHTGEKPYWCNNCGKTFCSKSNLSKHQRVHTGEGEVL
Download sequence
Identical sequences ENSPVAP00000004902 XP_006918706.1.64745 XP_011384619.1.92234 XP_015450086.1.64745 XP_015450087.1.64745 XP_015450088.1.64745 XP_015450089.1.64745 XP_015450090.1.64745 XP_015450091.1.64745 ENSPVAP00000004902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]