SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005534 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005534
Domain Number 1 Region: 302-436
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.98e-24
Family Eukaryotic proteases 0.00000889
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000005534
Domain Number - Region: 113-175
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000255
Family Pan module (APPLE domain) 0.021
Further Details:      
 
Domain Number - Region: 27-64
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00255
Family Pan module (APPLE domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005534   Gene: ENSPVAG00000005850   Transcript: ENSPVAT00000005850
Sequence length 442
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2711:171825:187248:1 gene:ENSPVAG00000005850 transcript:ENSPVAT00000005850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VISLYQMIHFILFASVSGECVTKLFKDICFQGGDIITVFTPSTKHCHIVCTHHPRCLFFT
FMNESSSEDPTKWFICIMKDSVTETLPRVNMRGAISGYSFKQYPHQISAYNKKIHVDLDM
KGVNYSGFITDAQECQERCTNDMHCYFFTYATRCFTIVEHCLFFTFLSQEWPKESVRNLC
LLETSKNGLSSTHIKKNEALSGFSLQNCRHSIPVFCHPSFYHDTDFLGEELDIVYVKRHE
TCQKICTNSIRCQFFIYSPSQESYNRKKGYLKLSSNGLPTKILHGRGGISGYTLRLCKMD
NECTTKIKPRFVGGTVSVHSEWPWQITLHITSPTRRHLCGSSIIGNQILTAAHRFEVNSA
KNLHVYSGILNQSEIKEDTSFWGVQEIIIYAQYKMAKSGDDIALLKLETTMNYTDFQRPL
PSERKRNIYSDCWMTGGYRKLI
Download sequence
Identical sequences ENSPVAP00000005534 ENSPVAP00000005534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]