SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005541 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005541
Domain Number 1 Region: 167-420
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-79
Family Eukaryotic proteases 0.0002
Further Details:      
 
Domain Number 2 Region: 45-166
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000000392
Family SEA domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005541   Gene: ENSPVAG00000005858   Transcript: ENSPVAT00000005858
Sequence length 421
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2309:92355:136452:-1 gene:ENSPVAG00000005858 transcript:ENSPVAT00000005858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMYRTVRFGTQSRDLKPWMIVLLTXXXXXXXXXXXXXXXXXXXXXQNIEYYHGTFKISDV
RINSNSGQNSTYQLEDLREMSENLVSQVDEIFRDSALNNHYVKNQVVRLTPEEEGIKADV
IMVFQFPSAEQREVRKKKIHSIFIQKIRNIRASSINASSVQVNAMSSSTGKLTVQACCGK
RVVPLIVNRIMSGDIAAKAAWPWQASLQSNNIHQCGATLISNTWLVTAAHCFKKNPNPHQ
WTVSFGTTINPPLMKRNVKRIIIHERYHSPAREYDIAVVQISPRVTFSDDIRRVCLPEPS
ASFRPNSTVYITGFGALFYGGESQNDLREARLKIISDDVCKQPHVYGNDIKFGMFCAGYL
EGIYDACRGDSGGPLVIKDLKDTWYLIGIVSWGDNCGQENKPGVYTKVVYYRNWIASKTG
L
Download sequence
Identical sequences ENSPVAP00000005541 ENSPVAP00000005541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]