SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005582 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005582
Domain Number 1 Region: 47-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.98e-36
Family SCAN domain 0.0000776
Further Details:      
 
Domain Number 2 Region: 958-1014
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 873-930
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 737-793
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.92e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 698-750
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.45e-18
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 6 Region: 778-830
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000399
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 920-951
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000027
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000005582
Domain Number - Region: 229-265
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0288
Family KRAB domain (Kruppel-associated box) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005582   Gene: ENSPVAG00000005899   Transcript: ENSPVAT00000005900
Sequence length 1033
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1228:15628:26507:1 gene:ENSPVAG00000005899 transcript:ENSPVAT00000005900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVALQSQAQTSPPAELDELLIVKLEEDTWRSESRPREKEHDPVSGREASRQRFRQFQYR
EAGGPHEAFSQLWALCCRWLRPEIRLKEQILELLVLEQFLTILPREVQAWVQARHPENGE
EAVALVEDWHREARAAGQREVELRAEETRSLKVVHESPADHWPEEQPQRQCMKNLCPDLP
KHLDTKVVPQTLKESAVLTPRVPTLPKMGSVGDWEVTAASQEALGPGRHAEKEFRKDSPG
DNCENGMSLGVPVSKPNIISQREQGPEFWSPSLINSGKRNTVDYSLDNEQTKPGPALAWR
DSRAWEEQYQWDVEDMKVSGVHWSYEETKTFLAILSESPFSEKLRTCHQNRQVYRAIAER
LRARGFLRTLEQCRYRVKNLLRNYRYASSHHGTCPFYEKLKLRARTAIRTEDSEAVAVPR
LGDSDAEVEEQEEGWGPEETAEDCNGDELATDESAQGPRIPGAPALFHSRVAGVHWGYEE
TKAFLTILSESSFSEKLRTCHQNSQVYRAIAERLCAQGFLRTLEQCRYRFKNLLRSYRKA
KSSHPPGTCPFYEELDSLVRARTAVRAMGTIREAAGLPMSGQSSTEADDQEAWDEMADED
SIKPPTPCPKTPDTGFEMRHEDEDQSSEQDIFEDLPGALSKCATEIVCHPHDWGEDSENE
NEGKGQWENPSQEQWEEYSSEEDLEKLIDHQGLYLAGKPYKCDTCVKSFSRSSHFIAHQR
THTGERPYKCLKCGKNFSDRSNLNTHQRIHSGEKPYRCLECEKSFSDHSNLVTHQRIHTG
EKPYKCGECWKSFNQSSNLLKHQRIHLGENPDHCSEPGENAGQSPSFSAHWRSLTEATSP
EQPQSASKNLNSSGPHSTNSGEKLYQCSECGRTFSKSSALISHQRIHTGEKPYECAECGK
SFSKSSTLANHQRTHTGEKPYKCTDCGKCFSERSKLITHQRVHTGEKPYKCLECGKFFRD
RSNLITHQRIHTGEKPYKCRECGKCFNQSSSLIIHQRIHTGEKPYKCLECGKDFNNSSHF
SAHRRTHAGGKAS
Download sequence
Identical sequences ENSPVAP00000005582 ENSPVAP00000005582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]