SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005659 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005659
Domain Number 1 Region: 327-577
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.67e-71
Family Eukaryotic proteases 0.0019
Further Details:      
 
Domain Number 2 Region: 114-223
Classification Level Classification E-value
Superfamily SRCR-like 6.67e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0047
Further Details:      
 
Domain Number 3 Region: 264-302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 227-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 5 Region: 49-109
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000147
Family Ovomucoid domain III-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005659   Gene: ENSPVAG00000005988   Transcript: ENSPVAT00000005989
Sequence length 586
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1788:229052:259855:-1 gene:ENSPVAG00000005988 transcript:ENSPVAT00000005989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLAHVILLLLCFYLSFCKVTSTSDTSHEDLVEKQCLTEKFTHLSCHKVFCQPWQKCIEG
KCICKLPYQCPKNGTTVCSTNGKSYPTYCQQKSLECIQPKAKFLNIGACTPSGQFYVSLK
YGNNESEGIVEVKLADQDKKMFICDNNWSMTQANVACLDLGFQQGALDTQGEFHFPEDHH
MNETDCLHVHCRGSETSLTECTFTKRRTESYQGLARVVCYTQNAVSPTKDSFQCVNGKYI
PQEKACDGINHCVDQSDELCCKGCRGDSFLCKSGVCIPNKYRCNGEVDCITGEDESDCEG
LLYMAQEETEMLTANMDAERKRIKSFFPKLSCGVKNSTPVRRKRVVGGMPAQVGDFPWQV
AIKDDGKINCGGVYIGGCWILTAAHCVRASKAHRYQIWTSLIDWIKLNSEIVIQRVNKVI
VHENYNRGTQQNDIALIEMKKPSNRRECMLPNSVPACVPWSPYLFHPNDTCIVSGWGREK
ANQKVYALKWGKVHLKANCSKFYPGRYFEKEMECAGTDDGIDACQGDSGGPLVCKDANNV
AYVWGVVSWGENCGDPEFPGIYTKVANYFDWISHHVGRSLISQHNV
Download sequence
Identical sequences ENSPVAP00000005659 ENSPVAP00000005659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]