SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005702 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005702
Domain Number 1 Region: 425-683
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-71
Family Eukaryotic proteases 0.0000000376
Further Details:      
 
Domain Number 2 Region: 19-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-29
Family Spermadhesin, CUB domain 0.000000801
Further Details:      
 
Domain Number 3 Region: 174-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-25
Family Spermadhesin, CUB domain 0.0000652
Further Details:      
 
Domain Number 4 Region: 359-429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0000379
Further Details:      
 
Domain Number 5 Region: 301-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000806
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 127-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000322
Family EGF-type module 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005702   Gene: ENSPVAG00000006033   Transcript: ENSPVAT00000006033
Sequence length 689
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_923:74640:81763:1 gene:ENSPVAG00000006033 transcript:ENSPVAT00000006033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWYIVLFSLLAWVSAEPTMYGEILSPNYPQAYPNEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIMSGGLEEGKICGQRTSKNPNSPIVEEFHIPYHKLQVIFKSDFSNEERF
TGFAAYYVAVDINECTDFADTPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGNVF
TALIGEIASPNYPDPYPENSRCEYQILLEEGFQVVVTVRREDFDVEPADSEGNCADSLVF
VTRDQQFGPYCGNGFPGPLNIESKSNALNIIFQTDQTGQKKGWKLRYHGDPTPCPKRVSA
NSVWEPEKAKYVFKDVVEINCLEGFEVVQGSVGSTSFYSICQSNGKWSNSKLKCQPVDCG
SPEPIQHGKFEDPEHTLFGSVTRYSCDEPYYYMQDEESGEYHCAGNGSWVNEVLGTELPR
CIPVCGTPNEVFEGKQRIFGGTFAQIQNFPWQVFFSNPRAGGALIDEYWVLTAAHVVEVN
QNPVMYVGSTSLTVAHLEKAQMLIADRVFIHPGWEFLENPETRKNFDNDIALVRLKDPVK
MGLTVSPICLPGISSEYNPSVGDLGLISGWGKTEVRDHVIMLRGAKVPIAPLLKCQEAKA
KNPKVSVNTYVFTDNMICAGGEKGVDSCEGDSGGALAIQDPNEKNPKFYVAGLVSWGPQC
GTYGIYTRVKNYIDWITKTMQENSTPSMD
Download sequence
Identical sequences ENSPVAP00000005702 ENSPVAP00000005702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]