SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005864 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005864
Domain Number 1 Region: 38-120
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.2e-31
Family SCAN domain 0.0000795
Further Details:      
 
Domain Number 2 Region: 247-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.45e-17
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 212-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000246
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005864   Gene: ENSPVAG00000006200   Transcript: ENSPVAT00000006200
Sequence length 294
Comment pep:known_by_projection scaffold:pteVam1:scaffold_15299:15997:18094:-1 gene:ENSPVAG00000006200 transcript:ENSPVAT00000006200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSEDQDGLQVVKGEQAPTWGQGPHLQNSWSGQEAAPFSHFCYQETPGPREALNRLWEL
CHQWLRPETHSKERIVELLVLEQFLAARPAELRAQVRGRCLESSEEAVAAVEDLEREFSE
PENQAPGYKHGHSEVLLEDVEHLKATQESAAIQLQSMVTQLKNESLGPHKFGEYDSETTP
ENQELALKQEVLKEIEHLGNSRLQRDVPLYFTYGRTCQHESRVEEQRGQATGERHHRCHE
CGKSSTQSSVLIQHQRIHTGEKPYQCSQCSKSVGWRTSLIKHQRTNTGERPYAC
Download sequence
Identical sequences ENSPVAP00000005864 ENSPVAP00000005864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]