SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000006008 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000006008
Domain Number 1 Region: 135-244,270-313
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.19e-31
Family Prokaryotic proteases 0.000034
Further Details:      
 
Domain Number 2 Region: 322-417
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-19
Family HtrA-like serine proteases 0.0019
Further Details:      
 
Domain Number 3 Region: 2-61
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000596
Family Growth factor receptor domain 0.0036
Further Details:      
 
Domain Number 4 Region: 47-95
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000501
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000006008   Gene: ENSPVAG00000006358   Transcript: ENSPVAT00000006358
Sequence length 420
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3010:4:26651:1 gene:ENSPVAG00000006358 transcript:ENSPVAT00000006358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPSPRCPGGYVPDLCNCCLVCAASEGEPCGRPLDSPCGESLECTRGACRCRWAHAVCGTD
GHTYANVCALQAASRRALQLSGTPVRQLQKGACPSXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXHPLFGRNVPLSSGSGFVMSEAGLIVTNAHVVSSTNTVSGRHQLKVQLQNGD
TYEATIKDIDKKSDIATVKIHPKKKLPALLLGHSADLRPGEFVVAIGSPGALQNTVTTGI
VSTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGEVIGINTLKVAAGISFAIP
SDRIARFLTEFQDKHVKDWKKRFIGIRMRTITPSLMEELKASSPDFPEVSKGIYVQEVVP
NSPSQRGGIQDGDIIVKVNGRPLADSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVL
Download sequence
Identical sequences ENSPVAP00000006008 ENSPVAP00000006008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]