SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000006098 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000006098
Domain Number 1 Region: 122-365
Classification Level Classification E-value
Superfamily vWA-like 2.78e-75
Family Integrin A (or I) domain 0.000000528
Further Details:      
 
Domain Number 2 Region: 335-451
Classification Level Classification E-value
Superfamily Integrin domains 1.2e-19
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 3 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000126
Family Plexin repeat 0.002
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000006098
Domain Number - Region: 457-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0146
Family EGF-type module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000006098   Gene: ENSPVAG00000006453   Transcript: ENSPVAT00000006454
Sequence length 769
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2517:3792:16753:-1 gene:ENSPVAG00000006453 transcript:ENSPVAT00000006454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCQCSLLLALAGLLSLGSVLSQECPKYKGGTCQECIQSGPGCAWCQKLNFTGPNEPNSV
RCDTREQLLSKGCAADDIMDPRSLAQTQEDQKGGRKQLSPQKVTVYARPGQAAVFNVTFP
PAKGYPIDLYYLMDLSYSMLDDLINVKKLGGXXXXXXXXXXXXXXXXFGSFVDKTVLPFV
NTHPEKLKNPCPNKEKECQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPNEIGWRNVTRLLVFATDDGFHIAGDGKLGAILTPNDGRCHLEDNMYKRSNEFD
YPSVGQLAHKLAESNIQPIFAVTKRMVKTYDKLTEIIPKSAVGELSEDSSNVVQLIKNAY
NKLSSRVFLEHSTLPDTLRVTYDSFCSNGVSQVNQPRGDCDGVQINDPVTFQVKVTAAEC
IQEKSFVIRALGFSDTVTVQVLPQCTCQCRDASRDRGLCLNKGSVECGVCRCDAGYIGKN
CECQTQGRSSQELEGNCRKDNASVICSGLGDCICGQCVCHASDTPTKKIFGRFCECNNFD
CERYGGHVCGGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXEKLKSQWNNENPLFKSATTTVMNPKFAES
Download sequence
Identical sequences ENSPVAP00000006098 ENSPVAP00000006098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]