SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000006375 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000006375
Domain Number 1 Region: 22-112
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.17e-37
Family SCAN domain 0.0000825
Further Details:      
 
Domain Number 2 Region: 431-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.9e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 360-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 319-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 482-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000178
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000006375   Gene: ENSPVAG00000006757   Transcript: ENSPVAT00000006756
Sequence length 515
Comment pep:known_by_projection scaffold:pteVam1:scaffold_6268:70985:85376:1 gene:ENSPVAG00000006757 transcript:ENSPVAT00000006756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVALGCAIQASLNQGSVFQEYDTDSEVFRQRFRQFQYKEAAGPHEAFNKLWELCCQWLK
PKMRSKEQILELLVLEQFLTILPTEIETWVREHCPENRERVVSLIEDLQRELEIPEQQMD
RQEVLLEDLAAVGMADIPPDIHLESPPLQAMGPVSEAPVTEVWIPQAGPQELSYGAAGEG
HPFLDPGYPIPKLDMSFPLEHREEAWVKELQDSKEIKQLLESKIGFEIGIENEEDTSKQK
KMENMYPFLVTLEGNALHGPILPKDYVQLENQWENPPEDLQTDLTKLVDHQNPSAGETAE
SSSLEEPLNPRPHKKKSPGDKPHRCSQCGKCFARKSQLTGHQRIHSGEEPHKCPECGKRF
LRSSDLYRHQRLHTGERPYECTVCKKRFTRRSHLIGHQRTHSEEETYKCLECGKSFCHGS
SLKRHLKTHSGEKPHRCHNCGKSFSRLTALTLHQRTHTEERPFKCNYCGKSFRQRPSLVI
HLRIHTGEKPYKCSHCSKSFRQRAGLIMHQVTHFR
Download sequence
Identical sequences ENSPVAP00000006375 ENSPVAP00000006375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]