SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000006476 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000006476
Domain Number 1 Region: 265-464
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.62e-52
Family Integrin alpha N-terminal domain 0.0000139
Further Details:      
 
Domain Number 2 Region: 761-967
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-40
Family Integrin domains 0.0027
Further Details:      
 
Domain Number 3 Region: 464-617
Classification Level Classification E-value
Superfamily Integrin domains 3.45e-26
Family Integrin domains 0.0026
Further Details:      
 
Domain Number 4 Region: 618-754
Classification Level Classification E-value
Superfamily Integrin domains 2.14e-20
Family Integrin domains 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000006476
Domain Number - Region: 33-109
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.000102
Family Integrin alpha N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000006476   Gene: ENSPVAG00000006860   Transcript: ENSPVAT00000006859
Sequence length 1035
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_867:153286:181256:1 gene:ENSPVAG00000006860 transcript:ENSPVAT00000006859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGLRLATRVPRQMLCALALMVAAGGRIASAFNLDTQFLVVKEARNPGSLFGYSVALHR
QTERRRRYLLLAGAPRDLAVPDGYTNRTGAVYLCPLTANKDDCERMDIGEKSDPDHHIIE
DMWLGVTVASQGPAGRVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSYMIQRKDWDLSEYSYK
GPEDQGNLYIGYTVQVGSAILHPTDITIVTGAPRHQHMGAVFLLSQEVGGDLRRRQVLEG
TQVGAYFGGAIALADLNNDGWQDLLVGAPYYFERKKEVGGAIYVFMNQAGTSFPAHPSLL
LHGPSHSAFGFSVASIGDINQDGFQDIAVGAPFEGLGTVYIYHSSSRGLLQQPQQIIHGE
KLRLPGLATFGYSLSGRMDVDENSYPDLLVGSLSDRIVLLRARPVINILYKTLVARPSVL
DPTLCTDSSCVQVELCFAYNQSAGNPNYRQNITLAYTLEADRDRRPPRLRFAQSQSAVFH
GFFSMPEMRCQTLELLLMDNVRDKLRPIIISMNYSLSLRMPERPRLALQSLDAYPVLNQA
QALENHTEVQFQKECGPDNKCDSNLEMQAAFVSEQGQPMSRLQYSRDFGKLLLSINVTNI
RSRQRAGEDAHEAQLTLAVPPALLPSSVRPFGACQGNETILCHLGNPFKRNQRMELLIVF
EVIGVTLHTRELQVQLQLSTSSQKNNLKPITLTLLVDYTLASLSMVSHRLQSYFGGTVMG
ESGMKTVEDVGSPLKYEFQVSPMGEGLAALGTLVLGLEWPYEVINGKWLLYPTEITIRGN
GSWPCQPPGDLVNPLNLTLSVPGDRLPSSQRRRQLDPGGGQGPPPATLAAAKKAKSETLL
SCGSDHTRCVWLECPIPDAPVITNVTVQARVWNSTFIEDYRDFDRVRVTSWATLFLRTSI
PTINMENKTVPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCDFFKRTH
YYQIMPKYHAVRIRE
Download sequence
Identical sequences ENSPVAP00000006476 ENSPVAP00000006476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]