SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000006484 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000006484
Domain Number 1 Region: 175-371
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.72e-57
Family Prokaryotic proteases 0.00000064
Further Details:      
 
Domain Number 2 Region: 386-482
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-22
Family HtrA-like serine proteases 0.0032
Further Details:      
 
Domain Number 3 Region: 40-127
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000033
Family Growth factor receptor domain 0.00087
Further Details:      
 
Domain Number 4 Region: 115-160
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000147
Family Ovomucoid domain III-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000006484   Gene: ENSPVAG00000006867   Transcript: ENSPVAT00000006867
Sequence length 485
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1753:132693:178440:1 gene:ENSPVAG00000006867 transcript:ENSPVAT00000006867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPARAVLPPLLLLLLPPLLLGARVSAQPSRAGRSPLSAAGCPERCEPARCASPPEPCEG
GRVRDACGCCEVCGAPEGAECGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASS
EPVCGSDANTYANLCQLRAASRRSERLRQPPVIVLQRGACGRGQEDPNSLRHKYNFIADV
VEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNG
ATYEAKIKDVDEKADIALIKIDHEGELPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTG
IVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAI
PSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVLSGAYII
EVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKKESTLNMVVRRGNEDTMITVIP
EEIDP
Download sequence
Identical sequences ENSPVAP00000006484 ENSPVAP00000006484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]