SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000006650 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000006650
Domain Number 1 Region: 6-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.36e-63
Family Eukaryotic proteases 0.00000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000006650   Gene: ENSPVAG00000007049   Transcript: ENSPVAT00000007049
Sequence length 244
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_538:177444:180362:-1 gene:ENSPVAG00000007049 transcript:ENSPVAT00000007049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLPLLFFLLCSRAEAGEIIRGTECKPHSRPYMAHLDVVTSQNDLKSCGGFLIRQNSVLT
AAHCEGSSIIVTLGAHNITEKEDTWQKLEVIKQFPHPKFDYTLTHHDIMLLKLKEKANRT
LAVGTLPLPSQFNFILPRRMCQVAGWGITEMDKSGSDTLQEVKLRLMDPKACTHFKMFEH
NLQLCMGNPRKTKSASKGDSGGPLLCVGVAHGIVFYGRKDVKLPVVFTRISHYRSWINEV
LKEN
Download sequence
Identical sequences ENSPVAP00000006650 ENSPVAP00000006650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]