SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000006811 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000006811
Domain Number 1 Region: 39-469
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.49e-77
Family Integrin alpha N-terminal domain 0.0000012
Further Details:      
 
Domain Number 2 Region: 469-626
Classification Level Classification E-value
Superfamily Integrin domains 2.35e-34
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 3 Region: 630-771
Classification Level Classification E-value
Superfamily Integrin domains 1.57e-26
Family Integrin domains 0.0044
Further Details:      
 
Domain Number 4 Region: 777-949
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-19
Family Integrin domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000006811   Gene: ENSPVAG00000007218   Transcript: ENSPVAT00000007219
Sequence length 1005
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1039:191096:263492:1 gene:ENSPVAG00000007218 transcript:ENSPVAT00000007219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPSENAWLGKRGAGRAPEAVREAVMLLLCLGVPSGRPYNVDTESALLYQGSPNTLFGYS
VVLHSHGENRWLIVGAPTANWLANSSVVNPGAIYRCIIGKNPNRTCEQLQLGSPGGEPCG
KTCLEERDNQWLGVTLSRQPGKNGSILTCGHRWKNIFYIKNENKLPTGVCYGVPSDLRTK
LSIRIAPCYQDYVRKFGENFASCQAGISSFYTEDLIVMGAPGSSYWTGSLFVYNITTNKY
KAFLDKDNQVKFGSYLGYSVGAGHFRNRHTTEVVGGAPQHEQIGKAYIFSIDAKELSILH
EMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSIIREEGRVFVYINSGSGTVMNEME
TELIGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLRGAIYIYNGRADGISSAFS
QRIELQISKSLSMFGQSISGQIDADNNGYVHVAVGAFRSDSVVLLRTRPVVVVEASLNHP
ESVNRTNFDCIENGLPSVCMDLTLCFSYKGKKVPGYIVLFYNMSLDVNRKAETPSRFYFS
SNGTSDVITGSMKVSSAVANCRTHQAFMRKDVRDILTPIQIEAAYHLGHHVISKRSTEEF
PPLQPILQQKNKKDIIQKTINFARFCAHENCSADLQISAKFEFLRPHENKTYLAVGSAKT
LMLNVSLFNAGDDAYETTLHIKLPTGLYFIKILDLEEKQINCEVTDSSGIVKLDCSVGYI
YVDHLSRIDVSFLLDASSLSRAEEDLNITVHAACENEGVTDNLKRNKVTVVVPLKYEVML
AVHGFVNPTSFVYGPEEDSEPETCMAEKMNFTFHVINTGHSVAPNVSVEIMVPNSFIPQT
DKLFNILDVQTTTGECHFKNYERKCSSEQXXXXXXXXXXXXXXXXXXXXXXXYCMKADPH
CLNFLCNFGKMESGKEVSVHIQLEGRPSVLEMDETSALKFEIRATAFPEPNPKVIELNKD
ENIAHVLLEGLHHQRPKRLFTVVIISSSLLLGLVLLLLISYVMWK
Download sequence
Identical sequences ENSPVAP00000006811 ENSPVAP00000006811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]