SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007152 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007152
Domain Number 1 Region: 40-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.75e-40
Family SCAN domain 0.0000426
Further Details:      
 
Domain Number 2 Region: 353-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 314-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.27e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 398-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 212-250
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000109
Family KRAB domain (Kruppel-associated box) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007152   Gene: ENSPVAG00000007576   Transcript: ENSPVAT00000007576
Sequence length 471
Comment pep:known_by_projection scaffold:pteVam1:scaffold_17856:11214:18359:1 gene:ENSPVAG00000007576 transcript:ENSPVAT00000007576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSQGLQPPPPLEQEGILIVKVEEDFSWEETSSLETEYPSPETFRQLFRLFCYQEVAGP
REALSRLWELCCHWLRPELHTKEQILELLVLEQFLTVLPGEIQAWVREQQPESGEEAVVL
VEGLQQEPRKQRGPETLSDDTVPDKTGKQSLKHQAEAQPEELSLEEGAWHSRKHLAQLSH
RPKRGFQFWPKRGSVASQHQETASAPKSFLSAWSQVPVTLEDVAVYLSQEEWGCLDSAQQ
DHSWDMLPESEGLGMQFEDGEDTRKDTPVRTEWDQMLSAQCRGPSPPTLVQEPAPVRGLT
RPGLERGGPQREAKSYTCPECGKGFNKTSHLTKHQRTHTGERPYQCPVCGKGFSDRSNFS
THQRVHTGEKPYRCPECGKCFSQSSSLVIHRRTHTGERPYVCAECGKRFSNSSHFSAHRR
THTGERPYMCPACGRGFRRGTDLHKHQRTHRREEPTAMPQLVAPGGPGVKA
Download sequence
Identical sequences ENSPVAP00000007152 ENSPVAP00000007152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]