SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007405 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007405
Domain Number 1 Region: 129-376
Classification Level Classification E-value
Superfamily vWA-like 1.33e-85
Family Integrin A (or I) domain 0.000000000359
Further Details:      
 
Domain Number 2 Region: 372-461
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-32
Family Integrin domains 0.0000041
Further Details:      
 
Domain Number 3 Region: 628-712
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.05e-24
Family Integrin beta tail domain 0.00000381
Further Details:      
 
Domain Number 4 Region: 25-79
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000785
Family Plexin repeat 0.0000396
Further Details:      
 
Domain Number 5 Region: 586-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family Integrin beta EGF-like domains 0.00037
Further Details:      
 
Domain Number 6 Region: 544-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000007405
Domain Number - Region: 513-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0248
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007405   Gene: ENSPVAG00000007845   Transcript: ENSPVAT00000007846
Sequence length 784
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3599:343437:386451:1 gene:ENSPVAG00000007845 transcript:ENSPVAT00000007846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRARPLWAAALVLGALAGGGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRC
NLKENLLTDNCALESIEFPISEASILEARPLSDKGSGDSSQITQVSPQRIALRLRPDDSK
SFSVQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLASQMRKLTSNLRIGFGAFVD
KPVSPYMYISPPEALKNPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDG
PEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSD
NHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTEEVVNLYQNYSELIPGTTVGVLSTDSS
NVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFS
IEAKVRGCPQEKEKSFAIKPVGFKDSLTVQVTFDCDCACQAHAEPYSRHCNNGNGTFECG
VCRCGPGWLGSQCECSEEDYRPSQQDECSPQEGQPVCSQRGECLCGQCVCHSSDFGKITG
KYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGR
GKCECGSCICIQPGSYGNTCEKCPTCPDACTFKKECVECKKFNRGTLLEENTCNRYCRDE
IESVKELKDTGKDAVNCTYKNEDDCVIRFQYYEDSSGKSILYVVEEPECPKGPDILVVLL
SVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNIT
YRGT
Download sequence
Identical sequences ENSPVAP00000007405 ENSPVAP00000007405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]