SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007412 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007412
Domain Number 1 Region: 73-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.1e-44
Family Eukaryotic proteases 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007412   Gene: ENSPVAG00000007855   Transcript: ENSPVAT00000007854
Sequence length 257
Comment pep:novel genescaffold:pteVam1:GeneScaffold_4090:1249:5591:1 gene:ENSPVAG00000007855 transcript:ENSPVAT00000007854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPLSLLWLLVAPGVLWTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXTQQLRLVLGLHTLRDPGLTFRARAAILHPEYKPAPHLENDLALLQLDG
KVRRSRTIQALALPRGRQAVAVGARCSVAGWGLTQQGGKLARALRELDVRVLDTRMCNNS
RFWHGGIAPGMVCLAAEAKNQAPCKGDSGGPLVCDKGHLAGVLSFSSTSCTDIFKPPVAT
AVAPYVSWIKKTIRRAC
Download sequence
Identical sequences ENSPVAP00000007412 ENSPVAP00000007412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]