SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007785 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007785
Domain Number 1 Region: 41-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-35
Family SCAN domain 0.0000471
Further Details:      
 
Domain Number 2 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 322-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.84e-21
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 230-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 411-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-18
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007785   Gene: ENSPVAG00000008240   Transcript: ENSPVAT00000008240
Sequence length 469
Comment pep:novel scaffold:pteVam1:scaffold_15060:5636:9401:-1 gene:ENSPVAG00000008240 transcript:ENSPVAT00000008240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQSRPSAALGAVSAEDRAGILSVKVEDEEAGSSRSPARGPERCRLRFRGFRYPEAGGP
REALRRLRQLCRLWLRPETHSKEQIVELLVLEQFLAVLPAELRARVRGRCPESGEEAVVL
LEGPQRQLDEPRPQVPGGDQGQWLCSKMAVLTPARRSRSPQFQPVKALLERESVGPQPSA
DGGGEMQTKIRDLPPGEEHPEQEPGQTPCHLGEAITQLRTCAEAGEREGSLQRKQKITTG
KRRHVCHECGKSFAQSSGLTKHRRIHTGEKPYECEECGKSFIGSSALIIHQRVHTGEKPY
ECDECGKVFGHSSDLIKHQRTHTGEKPYECEDCGKAFSQSCSLLEHHRIHTGEKPYQCNT
CGKAFRRNSHLLRHRRVHGDKDVQDPERGGTWEDQGRVERSEGSVEALVSYTCDECERSF
TRSRSLIEHQKIHTGEKPYQCDACGKGFARTSYLVQHQRSHGGKKILSR
Download sequence
Identical sequences ENSPVAP00000007785 ENSPVAP00000007785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]