SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008057 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008057
Domain Number 1 Region: 26-97
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000000161
Family Extracellular domain of cell surface receptors 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008057   Gene: ENSPVAG00000008532   Transcript: ENSPVAT00000008531
Sequence length 122
Comment pep:known_by_projection scaffold:pteVam1:scaffold_448:209734:217007:1 gene:ENSPVAG00000008532 transcript:ENSPVAT00000008531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKGGFVLLGLLLILFALYHSGHGLECYSCLNPINSCTKAINCSQNLDACLYVKAEERT
YYQCWKFDNCNFRYISKALGENKLEYDCCQKNLCNRNDAVRASGKTFLLLTQLLAAFWKF
FL
Download sequence
Identical sequences ENSPVAP00000008057 ENSPVAP00000008057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]