SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008319 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008319
Domain Number 1 Region: 45-129
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000000275
Family Snake venom toxins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008319   Gene: ENSPVAG00000008813   Transcript: ENSPVAT00000008812
Sequence length 171
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2188:234062:258003:1 gene:ENSPVAG00000008813 transcript:ENSPVAT00000008812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGPALAWLLLLSLLADCLKAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYE
CNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVALEECLSTGCRDSEHEGHKVCTS
CCEGNICNLPLPRNETDATFATTSPINQTNGRPHCVSVIVSCLWVWLGLTL
Download sequence
Identical sequences ENSPVAP00000008319 ENSPVAP00000008319 XP_011357834.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]