SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008334 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008334
Domain Number 1 Region: 150-208
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000116
Family Snake venom toxins 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000008334
Domain Number - Region: 53-126
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00269
Family Extracellular domain of cell surface receptors 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008334   Gene: ENSPVAG00000008828   Transcript: ENSPVAT00000008828
Sequence length 261
Comment pep:known_by_projection scaffold:pteVam1:scaffold_11805:36788:39059:-1 gene:ENSPVAG00000008828 transcript:ENSPVAT00000008828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILISFFILKEAMGFHHIQSLLFLFLLGASSLTLAQNLYCHKGISMSIKEDNSSAFNWTSE
KVETCDNNALCQESVLMIKSGAKAAVFVTKSCVSEGIPSITFAQHSPPPGIVAVSYSNYC
EDSLCNNKSDLPDFLWDSNLPSVSKASTTLRCPTCVALGNCLSAPSLLCPNGTTRCYQGR
LEIIGGDFDSTLEVKGCTSVIGCRLMSGILTVGPMWVKEMCPYQSLIQPRKIKNGATWLL
ISIRKLELLLLLLLQLLVHCS
Download sequence
Identical sequences ENSPVAP00000008334 ENSPVAP00000008334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]