SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008348 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008348
Domain Number 1 Region: 11-103
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 9.61e-41
Family SCAN domain 0.0000523
Further Details:      
 
Domain Number 2 Region: 688-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 745-801
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 786-838
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-18
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 5 Region: 640-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000867
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008348   Gene: ENSPVAG00000008846   Transcript: ENSPVAT00000008846
Sequence length 853
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2910:39484:48010:-1 gene:ENSPVAG00000008846 transcript:ENSPVAT00000008846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAKPTLRGNGTNSETFRQRFRKFHYQEVAGPREAFSQLWELCCRWLRPEVRTKEQIVEL
LVLEQFLTILPREIRKWVQEQCPESGEEAVALVEDLEREPGRPGRSVTVSVKGQEVRLEK
MTPLKSSQELLSVRQESVEHQPRGVPKKERARSPDLGPQEQMNPKEKLRPFQRSGSPLPK
SGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXTCPFFEEMEALMSAQVIRIPSNGLEEAASHSLLVGSDAETE
EPGHESWQHEGAGEDIAEESDSDETGQEATPQDPNNSTAPVLFRSPSGVHWGYEETKTYL
AILSETQFYEALRNCHRNSQLYGAVAERLWEYGFLRTPEQCRTKFKSLQTSYRKVKNGQA
PETCPFFEEMDALVSARVATPPSDGQEEDTASCPIQETSEAEAEKQAEEAEEATEDDDSE
DDEEDTELPPGAVMTRAPVLFQSPSGFEAGFENEDNLKRDISEEVQLHRTLLARSERKIP
RYLNQGKGSESDCRSGRQWERTPGERRGKSTLPERSLGKVLSHQRPYLGERPYKYLRYSK
SFGPNSQLMHQISHQVENPYKCADCGKSFSRSARLIRHRRIHTGEKPYKCLDCGKSFRDS
SNFITHRRIHTGEKPYQCSECGKRFNQSSSLIIHQRTHTGEKPYQCEECGKSFNNSSHFS
AHRRIHTGERPHVCPDCGKSFSKSSDLRAHHRTHTGEKPYGCHDCGKCFSKSSALNKHRE
IHTREKLLQSAPK
Download sequence
Identical sequences ENSPVAP00000008348 ENSPVAP00000008348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]