SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008669 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008669
Domain Number 1 Region: 173-452
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.4e-77
Family Eukaryotic proteases 0.000000118
Further Details:      
 
Domain Number 2 Region: 62-125
Classification Level Classification E-value
Superfamily GLA-domain 3.73e-23
Family GLA-domain 0.00024
Further Details:      
 
Domain Number 3 Region: 114-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000198
Family EGF-type module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008669   Gene: ENSPVAG00000009192   Transcript: ENSPVAT00000009191
Sequence length 467
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3790:295872:306946:1 gene:ENSPVAG00000009192 transcript:ENSPVAT00000009191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPQPCELSLLCFLLGLQGSLTTXXXXXXXXXXXXXXXXXXXXXXXFITQKEAQGVLHRQ
RRANWLLEELRAGSLERECREEQCSFEEAREIFKNDETLKQFWMSYKDGDQCSSNPCKNG
GSCEDHLQSYICFCPDNFEGRNCETNKNNQLICENENGGCEQYCSNHVEAKRSCWCHKGY
TLQADEVSCAPTVDYPCGKIPVLEKRNDSQPQGRIIGGKVCPKGECPWQVALKLNGVLLC
GGTLIDTTWVVSAAHCFDRFKSFKNLTAVVGEHDSEEDGDEQERQVAQVIVPNKYVTGKT
NHDIALLRVSRPVVFTDYVVPLCLPEKAFSERTLASIRFSFISGWGQLLERGATALQLMA
IDVPRLMTQDCLEQSTREQTSPKITENMFCAGYLDGSKDACKGDSGGPHATKFQGTWYLT
GVVSWGVGCAAVGHFGVYTRVSQYTEWLHRLVSSKEHSEGLLRAPFP
Download sequence
Identical sequences ENSPVAP00000008669 ENSPVAP00000008669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]