SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008671 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008671
Domain Number 1 Region: 147-174,229-469
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.78e-81
Family Eukaryotic proteases 0.0000000185
Further Details:      
 
Domain Number 2 Region: 40-103
Classification Level Classification E-value
Superfamily GLA-domain 1.46e-25
Family GLA-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008671   Gene: ENSPVAG00000009195   Transcript: ENSPVAT00000009193
Sequence length 487
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3790:311094:329937:1 gene:ENSPVAG00000009195 transcript:ENSPVAT00000009193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLLFLILLSASLAGLLVPGGSVFINREHAHTVLERARRANSFLEELKKGNLERECLEE
TCSYEEAREVFENIESTNEFWNKYKDGDQCESNPCQNQGECKDGLGEYTCTCSEGYEGKN
CELSTRKFCSLDNGDCDQFCSEEQSSVVCSCASGYILDDNGKSCISIEPFPCGKLTLGRR
KRSVAQASHSSKDPPETDMLEQYDPKDLHPTKDPFHLLDFNNTEPSPEEDEGSLIRIVGG
RDCREGECPWQALLINEENEGFCGGTILNEFYVLTAAHCLHQAKRFKVRVGERNTEKEEG
NEMAHEVEMIIKHNKFVKETYDFDIAVLKLKMPITFRMNVAPACLPEKDWAESTLMTQKS
GIVSGFGRTHEKGRTSTTLKMLEVPYVDRNTCKLSSKFSITTNMFCAGYDAKPEDACQGD
SGGPHVTRFKDTYFVTGIVSWGEGCAQKGKYGVYTKVTNFLKWIDRSMKAKARALSQQET
PTPSPLK
Download sequence
Identical sequences ENSPVAP00000008671 ENSPVAP00000008671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]