SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008674 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008674
Domain Number 1 Region: 113-375
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.17e-40
Family Eukaryotic proteases 0.00031
Further Details:      
 
Domain Number 2 Region: 19-80
Classification Level Classification E-value
Superfamily GLA-domain 1.03e-16
Family GLA-domain 0.001
Further Details:      
 
Domain Number 3 Region: 69-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000436
Family EGF-type module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008674   Gene: ENSPVAG00000009196   Transcript: ENSPVAT00000009196
Sequence length 375
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3790:339196:347021:1 gene:ENSPVAG00000009196 transcript:ENSPVAT00000009196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLPRSKANEVLIRWKRAGSYLLEEFFEGNLEKECYEEICVYEEAREVFENDVTTXXXXXX
XXXGTPCISQPCLNNGSCQDNIRTYTCTCSSGYEGRDCAFAKNECHPLRTDGCQHFCHPG
QESYMCSCAKGYKLDQDHKSCIPHEKCACGILTPKKQLDLQIFPWQVKLTNSKGKDFCGG
VIIQENFVLTTAKCSLLHRNISVKTNFHRTSKDPLMIEVKSVHVHMRYEEETGDNDISLL
ELVLPIQCPDVGLPICMPERDFMERILMPGTGGLLVGWTFNGSELGNTPMQTPVTHMDSK
ECGRDFNVTVTTRTYCERSSVGVVQWAEGSIVARKHKGTWFLTGILCSAPTEQYGHAFLL
TKVSRYSLWFRQIMK
Download sequence
Identical sequences ENSPVAP00000008674 ENSPVAP00000008674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]