SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008837 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008837
Domain Number 1 Region: 147-391
Classification Level Classification E-value
Superfamily vWA-like 4.45e-81
Family Integrin A (or I) domain 0.00000031
Further Details:      
 
Domain Number 2 Region: 391-481
Classification Level Classification E-value
Superfamily Integrin domains 2.04e-23
Family Integrin domains 0.0024
Further Details:      
 
Domain Number 3 Region: 644-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000602
Family Integrin beta tail domain 0.0069
Further Details:      
 
Domain Number 4 Region: 44-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000429
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 603-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Integrin beta EGF-like domains 0.008
Further Details:      
 
Domain Number 6 Region: 560-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Integrin beta EGF-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000008837
Domain Number - Region: 104-169
Classification Level Classification E-value
Superfamily Integrin domains 0.00251
Family Integrin domains 0.0035
Further Details:      
 
Domain Number - Region: 531-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family Integrin beta EGF-like domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008837   Gene: ENSPVAG00000009372   Transcript: ENSPVAT00000009373
Sequence length 798
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3521:338539:346782:-1 gene:ENSPVAG00000009372 transcript:ENSPVAT00000009373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVLSMVLVFLLVLSRSGSELDTKISSPGEATEWGDPDLSLPGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPVGELEEPQGWQEVLQDEPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLEFVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRMERCQPPFSFHHVLSLTGDAK
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSPEFDYPSVGQVAQALSAANIQPIFAVTSATLPVYQELS
KLIPKSAVGELSENSSNVVQLIMDAYNSLSSTVTLEHSPLPPGVRISYESQCGGPEKRDG
AAGDRGQCNNVRINQMVNFLVTLQATHCLQEPHLLRLRALGFSEELTVELHTLCDCNCSD
TQLQGPHCSDGQGYLQCGVCSCAPGRLGRFCECSEAELSSLDLESGCRAPNGTGPLCSGK
GQCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DIDGCVSPEGGLCNGHGHCKCNRCQCLDGYYGALCDQCPGCKTPCETHRDCAECGAFETG
PLATNCSMACAHANVTLAPAPILDDGWCKERTLDNQLLFFLIEDEAGGRVVLRVRPREKG
ADHTQAIVIGCVGGIVAVGLGLVLAYRLSVEIYDRREYNRFEKERQQLNWKQDSNPLYKS
AITTTVNPRFQETESPLL
Download sequence
Identical sequences ENSPVAP00000008837 ENSPVAP00000008837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]